www.cleveland.com – Myles Garrett Browns’ unanimous MVP in cleveland.com’s half-season awards – cleveland.com

Garrett was a no-brainer for our voters for MVP of the Browns this season.

Page Meta Tags

viewport width=device-width, initial-scale=1, minimum-scale=1
title Myles Garrett Browns’ unanimous MVP in cleveland.com’s half-season awards
twitter:title Myles Garrett Browns’ unanimous MVP in cleveland.com’s half-season awards
twitter:site @clevelanddotcom
twitter:card summary_large_image
article_publication_name https://www.cleveland.com/browns/2020/11/myles-garrett-browns-unanimous-mvp-in-clevelandcoms-half-season-awards.html
article_date_original Friday, November 06, 2020, 05:00 AM
article_date_updated Friday, November 06, 2020, 09:52 PM
sailthru_tags browns,football,cleveland-browns,myles-garrett,point,season,wyatt teller,larry ogunjobi
sailthru_date Friday, November 06, 2020, 05:00 AM
sailthru_title Myles Garrett Browns’ unanimous MVP in cleveland.com’s half-season awards
sailthru_author dlabbe
sailthru_description Garrett was a no-brainer for our voters for MVP of the Browns this season.
machine_tags @exclude-top
sections browns,sports
byline Dan Labbe, cleveland.com
subscriber_only false
description Garrett was a no-brainer for our voters for MVP of the Browns this season.
twitter:description Garrett was a no-brainer for our voters for MVP of the Browns this season.
twitter:image https://www.cleveland.com/resizer/PMRnc5cxhp25HN20o1ks09Z-B3A=/1280×0/smart/cloudfront-us-east-1.images.arcpublishing.com/advancelocal/JXH3D2FWDBB3BESIEC5NKOSYXI.JPG
article_author Dan Labbe | dlabbe@cleveland.com

Page Headers

0 HTTP/1.0 200 OK
Content-Type text/html; charset=utf-8
Server openresty
x-aws-lambda-call-status 200
ETag W/”3f38a-wycw3j1sXhdWdICFNKeHs0/DUPs”
Last-Modified Thursday, 12-Nov-2020 14:47:41 GMT
X-Akamai-Transformed 9 – 0 pmb=mRUM,2
Cache-Control private, max-age=60
Expires Thu, 12 Nov 2020 20:51:58 GMT
Date Thu, 12 Nov 2020 20:50:58 GMT
Connection close
Server-Timing Array
Content-Security-Policy upgrade-insecure-requests
Referrer-Policy no-referrer-when-downgrade

Keyword Frequency

browns 42
points 38
first 35
cleveland 25
half 24
on 22
season 22
votes 20
he 19
garrett 19

Keyword Cloud

Myles Garrett Browns unanimous MVP in cleveland com s half-season awards Skip to ArticleSet Weather Back To Main Menu Close Customize Your WeatherSet Location Enter City and State or Zip CodeSubmitSubscribe now Account Sign Large ChevronChevron that denotes content can open up Create account NewslettersHelp FAQ Search Understand big stories through our local lens Subscribe BrownsMyles awardsUpdated Nov Posted Cleveland defensive end walks the field during warm ups before game against Las Vegas Raiders Joshua Gunter Facebook ShareTwitter ShareBy Dan Labbe CLEVELAND Ohio Picking Most Valuable Player for x first half of season was easy tied NFL sack lead with Aaron Donald wrecking games opposing offenses strip sacks too a pick There wasn t even any room get cute it Our panel had vote Take look at from eight below The were voted on by Mary Kay Cabot Doug Lesmerises Scott Patsko Ellis Williams Each voter picked three people per category place worth points second third Below are results votes comments first-place A next player name means they received least one Runner-up Nick Chubb Others receiving Jarvis Landry Wyatt Teller Kareem Hunt Baker Mayfield point Comments who nine has become wrecker this he drafted be making changing strip-sacks regular basis He leading candidate Defensive Year will nail if his is as good defense struggled so weird saying features team but an choice been central many most important plays Not close makes all go when healthy best won thus him their Offensive First Half running back runs touchdown Washington Football Team Runners-up Odell Beckham Jr Joel Bitonio amp JC Tretter together offense just different ability level turn into great When you really think about incredibly difficult because there wide range solid candidates only standout missed far isn spectacular holds things gone offseason question mark run-blocking guard Out calf injury more run than recent weeks strapped almost singlehandedly Dallas touchdowns including game-saving -yard reverse TD caught pass victory over Bengals prevented teams being able stack box Without I m not sure how would move ball Also want show offensive line some love Those two inside stable gets hits Cincinnati quarterback Joe Burrow quarter Denzel Ward Ronnie Harrison Sheldon Richardson All four led scores victories those game-changing probably wouldn have five needed turnovers survive They seven fumble recoveries ve forced total responsible also You see much miss See my stepping Greedy remains M obvious winner put list around lot It speaks thin right Surprise center pull off play September FirstEnergy Stadium John Kuntz Bryant Chris Hubbard drops KhaDarel Hodge Donovan Peoples-Jones Malcolm Smith never gotten PFF grade above blocker seasons In Kevin Stefanski among guards Nobody saw coming While everyone fretted weak link other plans team-high pounds lean mass proved lineman changes filled gaping hole last Even optimistic fan couldn seen despite getting bit played well large doses asked didn ready block going long career Likely Break Second intercepts intended Indianapolis Colts receiver T Y Hilton pick-six October Rashard Higgins Austin Hooper Jedrick Wills keeps playing role continue Getting track return along handful suspect defenses left schedule should give opportunity efficient needs passes yards find way involved chemistry between improve path viewed corners duh Wish Were Here Award Grant Delpit safety training camp August Berea Andrew Billings Losing significant prompted out Poor lack coverage skill linebacker plagued could helped both areas We wonder what Instead we Sendejo elite premier players sorely value absence Disappointing Marcus Johnson catch defended free Larry Ogunjobi Karl Joseph David Njoku Olivier Vernon B J Goodson Mack Wilson paid million guaranteed wreak havoc take heat But notch until Sunday managed hurries ranked th edge-rushers according profootballfocus somewhat supposed special-teamer full-time Was hoping average once snapped bad Maybe unfair no expected Pro Bowl hard top flashes breakout contract year agency splash signed one-year deals Both disappointments neither likely Drops dead body language That shouldn happen pro football Assistant coach Bill Callahan talks rookie tackle Stump Mitchell Alex Van Pelt Chad O Shea Drew Petzing This renamed Let Recognize OL Play Season presided position group preparing No overall start Day coaching goes beyond linemen elder statesman staff guy tell better Best vs Cowboys reception earlier strip-sack Any may lost Dak Prescott trio receivers strike time preserve avoiding loss turning highlight still improbable rare crucial set game-winner So impressive Worst Minkah Fitzpatrick Pittsburgh Steelers interception six Heinz Field drop rd-and- screen secondary looks confused after gift-wrapped clear kicked week intense scrutiny straight completions quell let air balloon worst traits showed sucked life chance something motion series unfortunate events resulted serious doubts QB future Yikes New face masks sale where buy Browns-themed coverings coronavirus protection adults youth single mask -pack proceeds donated CDC Foundation More bye comes ideal posts consecutive encouraging outings heading upcoming decisions regarding midseason grades Who replaceable What OBJ present Terry Talkin Berry full force nd came within striking distance trades expects continued progress keep stand pat trade deadline Buy gear Fanatics Shop Amazon Lids Note readers purchase affiliate links earn commission DisclaimerRegistration use site constitutes acceptance User Agreement Privacy Policy Cookie Statement California Rights each updated Advance Local Media LLC rights reserved About Us material reproduced distributed transmitted cached otherwise used except prior written permission Community Rules apply upload submit Ad Choices

brownswire.usatoday.com – Myles Garrett will have MRI on injured knee on Monday

Myles Garrett will have MRI on injured knee on Monday

Page Meta Tags

viewport width=device-width, initial-scale=1.0
description Myles Garrett will have MRI on injured knee on Monday
keywords injuries, latest browns news, myles garrett, browns injuries, las vegas raiders vs. cleveland browns, myles garrett, stn
generator WordPress 5.5.2
gdpr false
onesignal wordpress-plugin
twitter:creator @TheBrownsWire
twitter:site @thebrownswire
twitter:text:title Myles Garrett will have MRI on injured knee on Monday
twitter:image https://brownswire.usatoday.com/wp-content/uploads/sites/48/2020/11/USATSI_15142903-e1604266684863.jpg?w=640
twitter:card summary_large_image
msapplication-tileimage https://brownswire.usatoday.com/wp-content/uploads/sites/48/2017/01/cropped-favicon_brownswire.png?w=270

Page Headers

0 HTTP/1.1 200 OK
Server nginx
Date Thu, 12 Nov 2020 20:50:57 GMT
Content-Type text/html; charset=UTF-8
Content-Length 155840
Connection close
X-hacker If you’re reading this, you should visit wpvip.com/careers and apply to join the fun, mention this header.
X-Powered-By WordPress VIP
Host-Header a9130478a60e5f9135f765b23f26593b
Link Array
Accept
X-rq dca7 103 47 3087
Cache-Control max-age=300, must-revalidate
Age 0
X-Cache hit
Vary Accept-Encoding
Accept-Ranges bytes
Strict-Transport-Security max-age=86400

Keyword Frequency

on 37
garrett 16
browns 15
afc 12
nfc 12
email 12
knee 11
he 10
myles 10
will 10

Keyword Cloud

Myles Garrett will have MRI on injured knee Monday Teams AFC East Bills Dolphins Jets Patriots North Bengals Ravens Steelers South Colts Jaguars Texans Titans West Broncos Chargers Chiefs Raiders NFC Cowboys Eagles Giants Washington Bears Lions Packers Vikings Buccaneers Falcons Panthers Saints Cards Niners Rams Seahawks Colleges Big Ten Michigan St Ohio Wisconsin SEC Alabama Auburn Florida Georgia LSU Tennessee Oklahoma Texas Notre Dame USC Schedule Injuries Newsletter Draft Fantasy Betting Odds About More Menu Share this Close share tweet text email link Facebook Twitter via message LinkedIn https brownswire usatoday com myles-garrett-will-have-mri-on-injured-knee-on-monday Sections Advertisement article shares Jeff Risdon November pm The bad news just keeps coming from the Cleveland Browns and loss to Las Vegas Defensive end undergo an his after being limited throughout Sunday s game indicated he took a shot early it bothered him rest of day had little visible impact His streak six consecutive games with sack ended After said play in Week as long can run though did offer caveat that is medical staff decision bye List vs recap Score stats stars more View items Like Sign up for Wire newsletter get our top stories your inbox every morning Email me all newsletters Stories Kevin Stefanski hopeful Nick Chubb has already been designated return reserve but doesn’t yet guarantee running back be available Sunday’s matchup Houston Coach splashed some cold water possibility press conference Thursday was asked if make lineup when host FirstEnergy Stadium head coach deferred saying anything definitive Instead offered cautious endorsement We’ll see Friday determination he’s ready Read full From Web Ads by Zergnet QB Deshaun Watson Romeo Crennel are huge fans leads NFL sacks leading contender Player Year seven forced turnovers This week’s opponent know what do too well Interim quarterback both clearly defensive They gushed about ability their conferences week He got great length first good off ball body flexibility so under injury report starting OL players active at practice returned field Wednesday begin prep earnest In pleasant development player -man roster participated least capacity Five were various ailments however Four them regular starters offensive line Left guard Joel Bitonio elbow Right tackle Jack Conklin Wyatt Teller calf Center JC Tretter Also linebacker Jacob Phillips who battling malady weeks banged negatively impacted Most Popular Podcast College Best Bets Report put waiver claim DE Takk McKinley Andy Janovich year nominee Salute Service Award Baker Mayfield activated COVID- list Follow BrownsWire Get See feed copy Copyright Terms Privacy Policy Your California Rights Do No Sell My Info Cookie Corrections Powered WordPress VIP Error Please enter address Success Thanks signing check confirmation Something went wrong xml version encoding UTF-

nypost.com – Myles Garrett contemplated quitting after brawl, suspension

As Myles Garrett prepares to take the field for the first time since the infamous helmet-swinging melee, the Cleveland Browns end reveals he was close to quitting the NFL.

Page Meta Tags

viewport width=device-width, initial-scale=1
copyright Copyright 2020 NYP Holdings. All rights reserved.
p:domain_verify 44b526edc36ffbcc163412ee9fe42833
robots max-image-preview:large
description As Myles Garrett prepares to take the field for the first time since the infamous helmet-swinging melee, the Cleveland Browns end reveals he was close to quitting the NFL.
generator WordPress 5.4.3
nypost-section Sports
parsely-metadata {“post_id”:”nypost-16273199″}
keywords Football,cleveland browns,mason rudolph,myles garrett,pittsburgh steelers
google-site-verification eyT36MjcFGn_qzUdS9VyWVb89Lq2f8-ItpI8WRksiyw
msvalidate_01 8188997BC82071CE07AB711B5675CE54
twitter:creator @SamanthaNFL
twitter:site @nypost
twitter:text:title Myles Garrett thought about quitting NFL after helmet incident
twitter:image https://nypost.com/wp-content/uploads/sites/2/2020/09/myles-garrett-cleveland-browns-2020.jpg?quality=90&strip=all&w=680&h=356&crop=1
twitter:card summary_large_image
twitter:title Myles Garrett thought about quitting NFL after helmet incident
twitter:description As Myles Garrett prepares to take the field this Sunday for the first time since the pivotal helmet-swinging melee, the Cleveland Browns defensive end reveals how close he was to ending his career,
twitter:image:src https://nypost.com/wp-content/uploads/sites/2/2020/09/myles-garrett-cleveland-browns-2020.jpg?quality=90&strip=all&w=680&h=356&crop=1

Page Headers

0 HTTP/1.1 200 OK
Server nginx
Date Thu, 12 Nov 2020 20:50:56 GMT
Content-Type text/html; charset=UTF-8
Content-Length 227032
Connection close
X-hacker If you’re reading this, you should visit wpvip.com/careers and apply to join the fun, mention this header.
X-Powered-By WordPress VIP
Host-Header a9130478a60e5f9135f765b23f26593b
Referrer-Policy no-referrer-when-downgrade
X-Content-Type-Options nosniff
X-XSS-Protection 1; mode=block
Link Array
Content-Security-Policy frame-ancestors *.nypost.com *.decider.com *.pagesix.com http://www.stumbleupon.com https://www.stumbleupon.com
X-rq dca5 102 67 3187
Cache-Control max-age=300, must-revalidate
Age 731
X-Cache hit
Vary Accept-Encoding
Accept-Ranges bytes
Strict-Transport-Security max-age=31536000

Keyword Frequency

email 15
garrett 14
was 14
on 11
myles 8
your 8
my 8
all 8
post 8
it 7

Keyword Cloud

Myles Garrett contemplated quitting after brawl suspension Skip to main content Thanks for contacting us We ve received your submission Back Reading Sections News Election Metro Page Six Sports Business Opinion Entertainment Fashion NY Post Shopping Living Media Tech Real Estate Video Photos Sub Menu Covers Columnists Horoscopes Odds Podcasts Email Newsletters Store Home Delivery Sign in Search Type Tips Up New York Share this Facebook Twitter Flipboard WhatsApp Copy thought about NFL helmet incident By Samantha Previte View author archive email the follow on twitter Get RSS feed Most Popular Today Look out below Horrifying pic shows snake eel burst of bird s stomach study reveals locations at highest risk spreading COVID- Biden popular vote lead over Trump grows more than million Construction worker killed forklift falls from bridge Celebrity pastor Carl Lentz alleged lover tells all I was a drug him Name required Comment Submit September am More On myles garrett has plan first post-brawl meeting with Steelers trying avoid ‘reality TV storyline’ against helmet-swinger star involved infamous getting Jamal Adams is handling wrong As prepares take field Sunday time since pivotal helmet-swinging melee Cleveland Browns defensive end how close he ending his career regardless reinstatement did think told cleveland com an interview Whether it because their decision or my whether going continue Life funny that way Fame fleeting athletic ability and you have make most while here would been OK love football competing teammates definitely want win but day m still guy young man who lot life live much just moved onto something else enjoy found another save competitive nature basketball team play baseball like Michael Jordan The Nov Thursday night game between AFC North rival Pittsburgh already rife tension before delivered coup de gr ce With eight seconds remaining swung opposing quarterback Mason Rudolph He alleges used racial slur claim backup denies believe everything happens reason said It seeing those lessons taking them stride What can get myself better person people around me chose stay help improve upon do How we Getty Images league swiftly suspended Pro Bowl lineman indefinitely nbsp without pay violating unnecessary roughness unsportsmanlike conduct rules longest history single on-field also enjoys poetry photography says away sport pushed reflect some difficult questions see be Who Was giving kind income coming All these things were mind writing coach whatever left head held high wouldn t looked back five-star recruit school played Texas A amp M three seasons earned All-SEC All-American honors twice impressive combine performance entered as Draft No overall pick reinstated February doesn clemency granted happened move forward given second chance best know won happen again exercised fifth-year option agreed five-year contract extension July will face off Ravens Baltimore Filed under browns mason rudolph pittsburgh steelers article Read Next Erin Andrews adapting new world Selection Mike Vaccaro Mets big run quirky pitcher Mark Cannizzaro Bryson DeChambeau isn lock Masters columnists PodcastTHE BEST INSIGHTS FROM THE ULTIMATE INSIDERS Blue Rush Giants Podcast Listen Apple Spotify Gang’s Here Jets Jalen Rose Renaissance Man SpotifySports latest odds top sports See what shop now Uniqlo launches long-anticipated collaboration Jil Sander Pharrell ready racism social justice early Black Friday deals cutest masks available online covering up style Walmart right Stories page six Ellen Portia unload mansion burglary nypost Why Fauci thinks pandemic longer Instagram LinkedIn YouTube Mobile Apps Contact Us Features Alexa Classifieds Feeds Subscribe Manage Subscription Help Support Customer Service App FAQ Newsroom Letters Editor Reprints Careers iPhone iPad Android Phone Tablet Advertise Kit copy NYP Holdings Inc Rights Reserved Terms Use Privacy Notice Your Ad Choices Sitemap California Do Not Sell My Personal Information Send Address Cancel not sent check addresses failed please try Sorry blog cannot share posts by click

www.pro-football-reference.com – Myles Garrett Stats | Pro-Football-Reference.com

Myles Garrett : Pos: DE, Career: 45 G, ProBowl, Browns 2017-2020, 1x Sk Leader, born TX 1995

Page Meta Tags

viewport width=device-width, initial-scale=1.0, maximum-scale=2.0
description Myles Garrett : Pos: DE, Career: 45 G, ProBowl, Browns 2017-2020, 1x Sk Leader, born TX 1995
revised 06:28:44 12-Nov-2020
handheldfriendly True
generated-by build_player_page.pl
format-detection telephone=no
apple-mobile-web-app-capable no
theme-color #384d42
msapplication-navbutton-color #384d42
apple-mobile-web-app-status-bar-style #384d42
keywords
twitter:card summary
twitter:site @pfref
twitter:creator @pfref
twitter:domain Pro-Football-Reference.com
referrer unsafe-url
msapplication-tilecolor #005629
msapplication-tileimage https://d2p3bygnnzw9w3.cloudfront.net/req/202011111/favicons/pfr/ms-tile-144.png

Page Headers

0 HTTP/1.1 200 OK
Content-Type text/html; charset=UTF-8
Connection close
Date Thu, 12 Nov 2020 20:50:55 GMT
Server Apache/2.4.6 (CentOS) OpenSSL/1.0.2k-fips mod_fcgid/2.3.9
X-Frame-Options SAMEORIGIN
Strict-Transport-Security max-age=2592000; includeSubDomains
Accept-Ranges bytes
X-Content-Type-Options nosniff
Referrer-Policy no-referrer-when-downgrade
Vary Accept-Encoding
X-Cache Hit from cloudfront
Via 1.1 44dc635ab5d687a3f3ece286c845d75a.cloudfront.net (CloudFront)
X-Amz-Cf-Pop YTO50-C3
X-Amz-Cf-Id OfMiadFgt_02_DSQu72gtxufBWL9qdxgflkm85g-W3H-OU-oLXWOXg==

Keyword Frequency

player 18
finder 18
game 18
career 16
garrett 14
football 12
nfl 12
pro 11
myles 10
more 9

Keyword Cloud

Myles Garrett Stats Pro-Football-Reference com Sports Reference Baseball Football college Basketball Hockey F tbol Blog Stathead Widgets Questions or Comments Welcome nbsp Your Account Logout Login Create MENU Players Teams Seasons Leaders NFL Scores Draft Newsletter Full Site Menu Below You are here PFR Home Page gt G Lorenz Superman Big Foot Position DE lb cm kg Team Cleveland Browns Born December in Arlington TX College Texas A M Weighted Career AV th overall since High School Martin the st round of Current salary More bio uniform draft info x Pro Bowl SUMMARY Sk Solo FF The Bengals record aided them Wednesday with Takk McKinley now Cincinnati-bound after a waiver claim Other suitors were ready to pounce if did not make ers See at ProFootballRumors Overview Gamelogs Player Game Finder Advanced Splits Fantasy Penalties Compare Coach Kevin Stefanski Next Sun Nov vs Texans Sheldon Richardson Olivier Vernon Jarvis Landry Case Keenum Jack Conklin Malcolm Smith Joel Bitonio Kareem Hunt Adrian Clayborn Andrew Sendejo J C Tretter Chris Hubbard Baker Mayfield Austin Hooper Larry Ogunjobi Kendall Lamm B Goodson Karl Joseph Denzel Ward Roster raquo Show entire roster Pages Probable Knee sustained knee injury previous game but it is expected that he will take on Sunday Updated November Sign up for free newsletter and get scores news notes your inbox every day View sample email It’s also available basketball baseball hockey p Up For Free Games Table Tackles Fumbles Off Snaps Def ST Date Week Tm Opp Result GS Ast Comb TFL QBHits Fmb FL FR Yds TD Num Pct CLE BALL CLECINW CLEWASW DALW CLEINDW PITL CINW CLELVRL Upcoming Bye CLEHOUPreview games Avg sk int tckl Last CLEPHIPreview JAXPreview Jaguars Schedule Defense amp Selected First-Team All-Pro Interceptions Year Age Pos No Int Lng PD Sfty CLELDE CLEde News Add Posts HerePlayer ArchivePlayer RSS FeedShow Hide Stories Snap Counts Since Appearances Leaderboards Awards Honors Combine Measurements Transactions Transaction fine suspension data Return Top In Tom Brady Jimmy Garoppolo Dalvin Cook George Kittle Christian McCaffrey Patrick Mahomes Popular Cam Newton Aaron Donald Russell Wilson Rodgers Odell Beckham Jr Watt Peyton Manning Julio Jones Antonio Brown Ben Roethlisberger Drew Brees Todd Gurley Hall Famers Bowlers MVPs Linker Tool AFC East Bills Dolphins Patriots Jets North Steelers Ravens South Titans Colts West Chiefs Raiders Broncos Chargers NFC Eagles Giants Cowboys Packers Bears Vikings Lions Saints Buccaneers Panthers Falcons Seahawks Cardinals Rams Season Passing Yards Single Rush Sacks All-time Find Score History Streak Super Winners Play Standings Schools All Colleges Coaches Active Bill Belichick Andy Reid Mike Tomlin Pete Carroll Historical Don Shula Halas Curly Lambeau Executives Bud Adams Scott Pioli Officials Ed Hochuli Tony Steratore Terry McAulay Matchups Points Allowed Stadiums Field Superdome Candlestick Park Fame AP MVP Frivolities Birthdays Uniform Numbers About Glossary Stat Minimums Articles Injury Risks Bell Curve We’re Social Statheads Every Media Thursday AM Question Comment Feedback Correction Are you too Subscribe our This Month out when we add feature change Do have sports website Or write about We tools resources can help use more FAQs Tip Tricks Learn Approximate Value Formula Details Win Probability Tips from blog Join linker program Watch How-To Videos Become access than imagine logos trademark property their owners LLC present purely educational purposes Our reasoning presenting offensive Logos compiled by amazing SportsLogos net Data Provided By official stats partner utilizes Official current seasons Copyright copy rights reserved Most provided creators ESPN Encyclopedia bull Privacy Statement Conditions Terms Service Advertise With Us Use

www.nfl.com – Myles Garrett Stats, News and Video – DE | NFL.com

Latest on DE Myles Garrett including news, stats, videos, highlights and more on NFL.com

Page Meta Tags

viewport width=device-width, initial-scale=1.0
description Latest on DE Myles Garrett including news, stats, videos, highlights and more on NFL.com
twitter:card summary
twitter:title Myles Garrett Stats, News and Video – DE | NFL.com
twitter:description Latest on DE Myles Garrett including news, stats, videos, highlights and more on NFL.com
twitter:image:src https://static.www.nfl.com/image/upload/v1554321393/league/nvfr7ogywskqrfaiu38m.svg
twitter:site @

Page Headers

0 HTTP/1.1 200 OK
Connection close
Content-Length 374942
content-type text/html
server envoy
access-control-allow-origin *
service-worker-allowed /
x-content-type-options nosniff
x-xss-protection 1; mode=block
x-frame-options deny
x-envoy-upstream-service-time 726
origin-site LA3
Via 1.1 varnish, 1.1 varnish
Cache-Control public, max-age=5
Accept-Ranges bytes
Date Thu, 12 Nov 2020 20:50:54 GMT
Age 0
X-NFL-Geo country_code=US
X-NFL-Dma 535
X-Served-By cache-nf-las9120-NF-LAS, cache-wdc5559-WDC
X-Cache HIT, HIT
X-Cache-Hits 1, 1
X-Timer S1605214255.907717,VS0,VE1
Vary Accept-Encoding,X-NFL-Geo,Origin

Keyword Frequency

nfl 70
garrett 37
myles 34
week 34
browns 33
icon 33
news 30
video 27
cleveland 23
defensive 22

Keyword Cloud

Myles Garrett Stats News and Video DE NFL com Skip to main content Open menu button Primary nav Scores Schedule Videos Teams Players Standings Inspire Change Photos Super Bowl Game Pass Crucial Catch Community Hispanic Heritage PRIDE Ways Watch En Espa xF ol Network Films Fantasy Tickets Shop Sign In Action related bull Cleveland Browns active Info Advertising Player Height Weight Arms Hands Experience College Texas A amp M Age Hometown Related Content Articles news season award predictions Russell Wilson edges Patrick Mahomes for MVP at midpoint Will win the first of his illustrious career Or will take home prize second time in three seasons At halfway point analysts predict awards Six players being asked do too much Do Vikings even HAVE an offense outside Dalvin Cook Gil Brandt ranks six NFL’s most disruptive defenders T J Watt lead Nick Shook eyes Which game-wrecker stands supreme or Buccaneers QB Tom Brady Titans RB Derrick Henry among Month October Justin Herbert way as best month Patriots Falcons Cowboys teams with frustrating losses Week From blowouts inexplicably blown leads excruciating defeats came all shapes sizes on Sunday Adam Schein identifies Nine style Mike Tomlin facing Steelers not looking ‘that reality TV storyline’ The last faced game ended a brawl has left that fracas past coach told reporters Tuesday he’s focused retribution but when face Biggest statements Raiders are real Who made biggest goes across spotlight number including Top candidates Aaron Rodgers field reveals top heading into Can anyone knock from perch five Defensive Year so far lists through some fresh faces rank highly nabbed NFC weekly while Garrett’s big earned him honors well AFC Offensive went non-quarterback this fact fiction poised end playoff drought Josh Allen Four Sundays trends takes emerging Is -year Are Seahawks favorites separates What watch Bengals-Browns Thursday night No picks Heisman Trophy winners Baker Mayfield Joe Burrow their squads Bengals clash p m ET exclusively Projecting share leaders defense it comes contributing team’s success Cynthia Frelund projects Sunday’s training camp injury roster Eagles Carson Wentz isn’t practicing is day-to-day after suffering minor soft tissue Ian Rapoport reports Keep track latest notes camps Quite simply ‘winning’ goal As emerges highlighted skills spotlighted career’s largest transgression pass rusher’s goals simple Winning Roundup Maxx Crosby returns practice was back Las Vegas therefore been activated off reserve COVID- list defensive placed Aug offensive-defensive duos Where Kansas City Chiefs quarterback safety Tyrann Mathieu Pats contenders despite attrition Jamal Adams perfect edition Scout’s Notebook Bucky Brooks explains why still offseason Plus examination Adams’ fit Seattle Alex Smith’s starting prospects Washington more ‘Top Five things voters got wrong Now Network’s complete Jeremy Bergman looks which didn’t get fair shake rankings Here Saints’ Cameron Jordan edge rushers Former All-Pro tackle Thomas KNOWS having spent years trying stop them He you can expect surprise Nos Jacobs enters It’s year again cast votes identify league wants ‘to promised land’ became highest-paid player history week he signed five-year million contract His next title reach agreement extension first-overall pick have reached worth sources Insider Wednesday Broncos’ Von Miller holds virtual rush summit Denver Broncos star hosted fourth annual holding session notable State Franchise This believe fell short expectations Rank examines chances finally making noise tough North video breaks down ahead ‘NFL Total Access’ Midseason choices crew gives midseason highlights Kinkhabwala ‘on mission’ prove Aditi shares how plan use vs matchup between Cincinnati strip-sacks turnover plays Pittsburgh clamps Big Ben huge sack sacks Roethlisberger Irvin Mooch debate bigger impact Michael Steve Mariucci matchups McGinest ‘He’s going run away with’ Willie Year’ Every game-changing play by Browns’ against Indianapolis Colts collapses Philip Rivers Why could be problem PFF elite four weeks PFF’s George Chahrouri writer Next Gen How skill took over Media’s day wide receiver Odell Beckham Jr helped hold Dallas Cowboys’ comeback attempt every flies third strip-sack many games uses epic spin move before sacking Dak Prescott Club Highest-graded grade Check out Football Team dominates LT stellar recovery Geron Christian links East South West General Media Contact Us Public Relations Privacy Policy Communications FAQ Careers Terms Conditions Guides Rule Book Accessibility Record Fact Sitemap Activate CTV Initiatives Rush Auction Play Services Health Safety Engagement Legends Alumni Association Care More Sites sites USA Operations On Location Pro Hall Fame Licensing Extra Points Credit Card Ticket Exchange Download Apps xA Enterprises LLC shield design registered trademarks National League team names logos uniform designs indicated All other NFL-related footage Productions Legal Service arrow icon right Close Copy Url Three dots Down Email Exit Fullscreen External link Facebook logo Instagram Snapchat YouTube TikTok Spotify LinkedIn Grid Key Left Link Mail Menu Phone Radio Rewind Right Search Select Selected Twitter Up User Audio iconAdd calendar iconNFC Carousel IconList ViewWebsite InstagramTwitterFacebookSnapchatShop IconProfile Overlay AvatarAddAirplayArrow LeftArrow RightArrow UpArrow DownAudioBack sBack sCalendarChartCheckDownLeftRightUpChromecast OffChromecast OnCloseClosed CaptionsBench OffBench OnBroad OffBroad OnVertical OffVertical OnCommentDockDoneDownloadDraftFantasyFilterForward sForward sFull Screen OffFull OnGamepassGamesInsightsKeyLeaveLiveCombineDraftFantasyMenu GamesMenu NetworkMenu NewsMenu PlayoffsMenu BowlMenu ShopMenu StandingsMenu StatsMenu TeamsMenu TicketsMenuMore HorizontalMore VerticalMy LocationNetworkNewsPauseplayMultiple PlayersSingle PlayerPlaylistPlayoffsPro BowlPurgeRefreshRemoveReplaySearchSettingsShare AndroidShare URLShare EmailShare FacebookShare InstagramShare iOSShare SnapchatShare TwitterSkip NextSkip PreviousStandingsStarStatsSwapTeamsTicketsVideoVisibility OffVisibility OnVolume HiVolume LowVolume MediumVolume MuteWarningWebsite Caret downCaret upAt browser using no longer supported site It recommended versions order receive optimal viewing experience following browsers Chrome Edge v later Firefox Safari Got

en.wikipedia.org – Myles Garrett – Wikipedia

Page Meta Tags

resourceloaderdynamicstyles
generator MediaWiki 1.36.0-wmf.16
referrer origin-when-cross-origin

Page Headers

0 HTTP/1.0 200 OK
Date Thu, 12 Nov 2020 18:56:46 GMT
Server mw1399.eqiad.wmnet
X-Content-Type-Options nosniff
P3p CP=”See https://en.wikipedia.org/wiki/Special:CentralAutoLogin/P3P for more info.”
Content-Language en
Vary Accept-Encoding,Cookie,Authorization
X-Request-Id a388336d-d086-4bba-9fc6-f98e78760b04
Last-Modified Thu, 12 Nov 2020 04:57:48 GMT
Content-Type text/html; charset=UTF-8
Age 6846
X-Cache cp1077 miss, cp1087 hit/11
X-Cache-Status hit-front
Server-Timing cache;desc=”hit-front”
Strict-Transport-Security max-age=106384710; includeSubDomains; preload
Report-To { “group”: “wm_nel”, “max_age”: 86400, “endpoints”: [{ “url”: “https://intake-logging.wikimedia.org/v1/events?stream=w3c.reportingapi.network_error&schema_uri=/w3c/reportingapi/network_error/1.0.0” }] }
NEL { “report_to”: “wm_nel”, “max_age”: 86400, “failure_fraction”: 0.05, “success_fraction”: 0.0}
Set-Cookie Array
X-Client-IP 18.191.61.31
Cache-Control private, s-maxage=0, max-age=0, must-revalidate
Accept-Ranges bytes
Content-Length 226894

Keyword Frequency

garrett 139
myles 61
com 56
retrieved 54
nfl 52
browns 51
football 41
was 38
on 35
amp 32

Keyword Cloud

Myles Garrett Wikipedia From the free encyclopedia Jump to navigation search American football defensive end GarrettGarrett in No Cleveland Browns Position Defensive endPersonal informationBorn December age Arlington TexasHeight ft m Weight lb kg Career informationHigh school Martin College Texas A amp MNFL Draft Round Pick history present Roster status ActiveCareer highlights and awards Second-team All-Pro Pro Bowl PFWA All-Rookie Team First-team All-American All-SEC Bill Willis Award NFL statistics as of Week Total tackles Sacks Forced fumbles Fumble recoveries Player stats at comPlayer PFR Lorenz born is an for National Football League He played college M was drafted by first overall highest-rated player ever recruited where he became a two-time while playing Aggies racking up numerous other his play Upon joining rookie season limited due injuries but emerged after latter half that year has become one premier edge rushers In suspended indefinitely fight occurring game against Pittsburgh Steelers before being reinstated early Contents High career Freshman Sophomore Junior Statistics Professional Personal life References External links edit attended School letterman basketball track had sacks senior rated five-star recruit Rivals com recruiting network ranked second best class committed University October field state qualifier throwing events with top-throws meters shot put discus throw US sports information high athletes Name Hometown Height Commit date DE James HS Oct Recruiting star ratings Scout Sports ESPN Overall rankings Note many cases may conflict their listings height weight these average taken grades are on -point scale Sources Commitments Retrieved November Commits Rankings Ranking came prospect nation signed As true freshman broke M’s sack record only six games nine Jadeveon Clowney’s SEC eight finished total loss quarterback hurries blocked kick which teammate Deshazor Everett returned touchdown Auburn consensus selection After conclusion announced would undergo surgery repair torn ligaments hand injury occurred sixth Mississippi State followed stellar campaign leading sophomore recorded solo seven five forced punt Alabama addition interception off own-tipped ball Ole Miss The earned first-team Walter Camp Foundation Writers Association America also winner top lineman Garrett’s junior found him suffered high-ankle sprain left leg fourth Arkansas did not appear South Carolina New Mexico availability third downs some recovered from For them two pass breakup resulted earning Unanimous Consensus designation voted Coaches Sporting News Associated Press Fox Focus SB Nation On officially declared intentions enter Defense Year GP Tackles Loss Int FF totals decision forgo remaining eligibility projected be ten analyst Mel Kiper Jr s big board Scouting Combine Indianapolis completed majority combine drills opted skip three-cone drill short shuttle solidified position pick impressive performance His vertical jump all linemen bench press broad fastest -yard dash highly impressed scouts size March Day chose perform video workout pre-draft visits Jacksonville Jaguars San Francisco ers Chicago Bears At process draft selected Illustrated DraftScout rusher Mike Mayock Pre-draft measurables Arm length Hand split Three-cone Vertical Broad Bench reps All values highest select overalll receives phone call May fully guaranteed four-year million contract features signing bonus offset language options team option fifth Browns’ training camp entered slated starting Head coach Hue Jackson named Emmanuel Ogbah ends begin regular They started alongside Trevon Coley Jamie Meder September ankle during practice causing miss start missing four York Jets sacked Josh McCown twice including once lost Despite having three woes continued concussion Tennessee Titans Because protocol could travel London next combined defensed fumble recovery Due still captain week Ben Roethlisberger both were tie Sam Darnold win Tampa Bay Buccaneers Jameis Winston overtime tackles-for-loss hits passes th fellow players Top Players Marcus Mariota During roughing passer penalties won fined fouls face mask hit Delanie Walker well Trevor Siemian tearing ACL putting injured reserve Seattle Seahawks Russell Wilson Rudolph reacts immediately head seconds regulation pulled Mason ground held there threw screen running back Trey Edmunds While wrapped attempted pull helmet unsuccessful getting gripped Rudolph’s facemask eventually removing offensive Maurkice Pouncey David DeCastro tried push away then swung striking underside ensued tackle Larry Ogunjobi ejected punched kicked several times strike pushed helmetless stood watching actions called into question own interviews conducted Baker Mayfield action inexcusable Freddie Kitchens expressed embarrassment later apologized described foolish out character same time thanking those who backed day missed remainder appealed suspension it upheld claimed directed racial slur required meet officials office Commissioner Roger Goodell order second-longest on-field misconduct longest single in-game incident longer period Vontaze Burfict violations safety rules February April exercised fifth-year five-year extension July Cincinnati Bengals strip Joe Burrow Washington Dwayne Haskins himself Dallas Cowboys Dak Prescott turnover AFC more month closed Month compiling Games Interceptions Fumbles GS Comb Ast Sck SFTY PDef Yds Avg Lng TD FR CLE Stats half-brother Sean Williams standout Boston number round NBA Jersey Nets Brea older sister athlete She NCAA title -pound champion Aggie offseason decided stop using social media account Twitter citing There’s lot negativity I don t need my felt like If want move forward person people’s opinions things stick me or mind when have keep doing resumed regularly writes poetry working dinosaur book children days along rounders Jabrill Peppers Njoku Progressive Field ceremonial pitch aiming instant relief prized Antonio Express-News commits MileSplit b Five-Stars History Gigem former already creating havoc living hype Blog- breaks Clowney Individual Leaders requests prayers Tuesday Update cfbstats Andy Hutchins can do everything blocking punts SBNation Vox Media tips incredible VIDEO FOX All-America Teams Announced FWAA gt AutoNation www sportswriters net AGGIE SOPHOMORE MYLES GARRETT WINS BILL WILLIS AWARD Archived copy original CS maint archived link Armani Watts vs spotted walking boots Says Is Good Enough To Play Well Face First Second waltercamp org PDF All-Americans AP Sports’ Lamar Dalvin Cook highlight PFF’s news analysis profootballfocus Here’s declares Khan January Kiper’s Big Board Davis Scott world certain freakish numbers BusinessInsider c DS nfldraftscout Goodbread Chase RBs reportedly visiting schedule Burke Chris Prospects si Legwold Jeff draft’s Mayock’s Events Profiles Sessler Marc turn around program Drafted Alumni pro-football-reference Patra Kevin sign first-rounder deal Spotrac McNanamon Pat first-round picks release depth chart wkyc sidelined starts ruled versus Vikings Pro-Football-Reference August captains WKYC don’t lose sloppy espn Won beat since Catanzaro’s FG OT lifts Bucs over Leaderboards Game Log Records CBSSports racked appeals trio fines says won’t change style Wilson’s TDs lead Seahawks’ rally past Times Faces Suspension Hitting Quarterback With Helmet via NYTimes Three nasty brawl tarnishes Steelers-Browns Rosenstein apologizes brutal attack Steelers’ doesn’t sound means NJ Advance Publications indefinite ban now Jake Trotter Brooke Pryor gets -game Gribble Andrew exercise th-year ClevelandBrowns signs QB Tom Brady RB Derrick Henry among fs ncaa Halliburton Suzanne cancels because Statesman U Statesmen throws Country Wikimedia Commons related profile vteCleveland rosterActive Cody Parkey Case Keenum Gillan Taywan Taylor Donovan Peoples-Jones KhaDarel Hodge Tavierre Thomas Denzel Ward Sendejo Dontrell Hilliard Kareem Hunt Johnson Sheldrick Redwine D’Ernest Janovich Ronnie Harrison Robert Jovante Moffatt J Stewart Terrance Mitchell Karl Joseph Sione Takitaki Charley Hughlett Jacob Phillips Mack Elijah Lee Nick Harris Olivier Vernon Tae Malcolm Smith C Tretter Kendall Lamm Jedrick Wills Hubbard Joel Bitonio Wyatt Teller Jack Conklin Jarvis Landry Austin Hooper Rashard Higgins Bryant Stephen Carlson Jordan Elliott B Goodson Adrian Clayborn Vincent Porter Gustin Sheldon Richardson Reserve lists Odell Beckham IR JoJo Natson Grant Delpit Chubb Greedy Young Curtis Weaver Pridgeon Opt-out Colby Gossett Drew Forbes Billings Drake Dorbeck George Obinna Practice squad Matt McCrane Ryan Switzer Inj Kyle Lauletta Green Montrel Meander Johnny Stanton Benton John Kelly Alex Joey Ivie Michael Dunn Cameron Malveaux Ja’Marcus Bradley Markway Franks Denmark Javon Patterson East BUF MIA NE NYJ North BAL CIN PIT HOU IND JAX TEN West DEN KC LV LAC NFC DAL NYG PHI WAS CHI DET GB MIN ATL CAR NO TB ARI LAR SF SEA vte selectionsOffense D’Onta Foreman WR Corey Dede Westbrook O’Connell Ramczyk Cam Robinson Connor Elflein TE Butt Jonathan Allen Derek Barnett DeMarcus LB Zach Cunningham Reuben Foster CB Minkah Fitzpatrick Adoree’ Jourdan Lewis Tre’Davious White S Budda Malik Hooker Special teams P Mitch Wishnowsky PK Zane Gonzalez Quadree Henderson vteNational Berwanger Francis Aldrich Cafego Harmon Dudley Sinkwich Bertelli Trippi Dancewicz Fenimore Gilmer Bednarik Hart Rote Wade Babcock Shaw Glick Hornung Hill Duncan Cannon E Parks Frederickson Nobis Bu Yary Simpson Bradshaw Plunkett Patulski Matuszak Jones Bartkowski Selmon Bell Campbell Cousineau Sims Rogers K Elway Fryar Br Testaverde Bruce Aikman Maryland Emtman Bledsoe Wilkinson Carter Pace Manning Couch Brown Vick Carr Palmer Long Stafford Bradford Newton Luck Fisher Goff Murray selections Trubisky Solomon Leonard Fournette Jamal Adams Christian McCaffrey Ross Patrick Mahomes Marshon Lattimore Deshaun Watson Haason Reddick Marlon Humphrey O Howard Garett Bolles Jarrad Charles Evan Engram Gareon Conley Takkarist McKinley Taco Charlton T Watt Carpenter Konz Rechichar Agganis Atkins Bauer Burris Shofner Kreitling Houston Crespino Collins L Hutchinson Warfield Morin Matheson Upshaw Phipps McKay Darden Holden Pruitt R Newsome Matthews Dixon Banks Junkin Metcalf Turner Vardell Everitt Langham Alexander Powell Warren Faine Winslow Edwards Wimbley Quinn Haden Weeden Mingo Gilbert Manziel Shelton Erving Coleman DeShone Kizer Roderick Caleb Brantley Matthew Dayes https en wikipedia w index php oldid Categories birthsLiving peopleAmerican endsCleveland playersTexas playersAll-American playersAfrican-American footballSportspeople TexasPlayers TexasHidden categories titleArticles descriptionShort description different WikidataUse mdy dates currentteam parameter articlesInfobox biography articles alt textCommons category Wikidata Navigation menu tools Not logged inTalkContributionsCreate accountLog Namespaces ArticleTalk Variants Views ReadEditView More Search Main pageContentsCurrent eventsRandom articleAbout WikipediaContact usDonate Contribute HelpLearn editCommunity portalRecent changesUpload file Tools What hereRelated fileSpecial pagesPermanent linkPage informationCite this pageWikidata item Print export Download PDFPrintable version projects Languages DeutschEspa olFran aisItaliano Portugu Edit This page last edited UTC Text available under Creative Attribution-ShareAlike License additional terms apply By site you agree Terms Use Privacy Policy registered trademark Inc non-profit organization policy About Disclaimers Contact Mobile view Developers Cookie statement

www.espn.com

Latest on Cleveland Browns defensive end Myles Garrett including news, stats, videos, highlights and more on ESPN

Page Meta Tags

description Latest on Cleveland Browns defensive end Myles Garrett including news, stats, videos, highlights and more on ESPN
twitter:site espn
twitter:url https://www.espn.com/nfl/player/_/id/3122132/myles-garrett
twitter:title Myles Garrett Stats, News, Bio | ESPN
twitter:description Latest on Cleveland Browns defensive end Myles Garrett including news, stats, videos, highlights and more on ESPN
twitter:card summary
twitter:image https://a.espncdn.com/combiner/i?img=/i/headshots/nfl/players/full/3122132.png
twitter:app:name:iphone ESPN
twitter:app:id:iphone 317469184
twitter:app:name:googleplay ESPN
twitter:app:id:googleplay com.espn.score_center
title Myles Garrett Stats, News, Bio | ESPN
medium website
viewport initial-scale=1.0, maximum-scale=1.0, user-scalable=no

Page Headers

0 HTTP/1.1 200 OK
Content-Type text/html; charset=utf-8
Content-Length 293879
Connection close
Vary Array
Date Thu, 12 Nov 2020 20:50:52 GMT
Server nginx/1.16.1
Expires Thu, 12 Nov 2020 20:54:56 GMT
Last-Modified Thu, 12 Nov 2020 20:54:56 GMT
Content-Security-Policy frame-ancestors ‘self’ *.espn.com:* *.espnqa.com:* *.espnsb.com *.espn.co.uk *.espndeportes.espn.com *.espn.com.br *.espn.com.mx *.espn.com.ve *.espn.com.ar *.espn.com.co *.espnfc.com.au *.espn.com.au *.espn.in *.espn.com.sg *.espn.cl *.espn.com.pe *.espn.com.gt *.espn.com.do *.espn.com.ec *.espn.com.uy *.espn.com.pa *.espn.co.cr http://*.espnqa.com:* http://*.espn.com:*
Via 1.1 varnish-v4, 1.1 87dd3e1dc66fe7262f68988c543f1f52.cloudfront.net (CloudFront)
Accept-Ranges bytes
Set-Cookie Array
Cache-Control max-age=0, must-revalidate
X-Cache Miss from cloudfront
X-Amz-Cf-Pop YTO50-C1
X-Amz-Cf-Id xjvW_YbF_eM7QW9l0sjR-w8bfMLUzCYBOy4b53SEKbqhcWpkxVaN3Q==

Keyword Frequency

garrett 11
vs 10
tickets 9
myles 8
browns 7
left 5
sun 5
nfl 4
steelers 3
cleveland 3

Keyword Cloud

Myles Garrett Stats News Bio ESPN Skip to navigationMenu ESPNNFL NBA MLB Soccer NCAAF MMA Watch Listen Fantasy Cleveland Browns Defensive EndFollowHT WT x quot lbsDOB CollegeTexas A amp MDraft Info Rd Pk CLE StatusActive season statsSOLO SACK Tied- stFF stINT Overview Splits Game Log Switch PlayerArizona CardinalsAtlanta FalconsBaltimore RavensBuffalo BillsCarolina PanthersChicago BearsCincinnati BengalsCleveland BrownsDallas CowboysDenver BroncosDetroit LionsGreen Bay PackersHouston TexansIndianapolis ColtsJacksonville JaguarsKansas City ChiefsLas Vegas RaidersLos Angeles ChargersLos RamsMiami DolphinsMinnesota VikingsNew England PatriotsNew Orleans SaintsNew York GiantsNew JetsPhiladelphia EaglesPittsburgh SteelersSan Francisco ersSeattle SeahawksTampa BuccaneersTennessee TitansWashingtonQuarterbackWide ReceiverRunning BackTight EndPlace KickerPunterDefensive BackLinebackerDefensive LinemanOffensive LinemanSpecial TeamsMyles Jordan Elliott Larry Ogunjobi Sheldon Richardson Vincent Taylor Adrian Clayborn Porter Gustin Joe Jackson Olivier Vernon Full RosterBrowns Quick LinksStats Schedule Depth Chart NFL LinksScores Standings Next GameFull SplitsTexans FOX Tackles Sacks Forced Fumbles Interceptions SplitsTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKBHome vs AFC Nov DefensiveSee AllStatsRegular SeasonProjectedLast GamesCareerTOTSOLOASTSACKFFFRYDSINTYDSAVGTDLNGPDSTFSTFYDSKB Recent GamesSee AllTacklesFumblesInterceptionsDateOPPResultTOTSOLOASTSACKSTFSTFYDSSun LV L Sun CIN W PIT IND DAL Latest NewsSee AllRacing PositionsBarnwell s midseason awards Mahomes Wilson or Rodgers for MVP dBill BarnwellWeather injury doom in low-scoring loss dJake TrotterGarrett expects clean fair game after fracas MJake TrotterBrowns playing at elite level going into Steelers rematch Behind the turnarounds return of and what win means MBrooke Pryor Jake TrotterTomlin focused on facing not PryorPhilip Rivers turnovers responsible nine points Colts MMike WellsColts rule out Leonard Castonzo WellsNFL quarter-season Barnwell picks ROY top coach best catch more MBill BarnwellRanking linemen We combined offense defense MPro Football FocusData provided by Elias Sports BureauLatest Videos pens a message ClevelandMyles How deal with is down can also hoop See AllFind TicketsVividSeatsBrowns Texans FirstEnergy Stadium Tickets as low Buy tickets VividSeatsOther Games Search TeamAll left Eagles Jaguars Titans Ravens lefthidden North StandingsTeamWLTPCTPFPAPittsburgh Baltimore Cincinnati Terms UsePrivacy PolicyYour California Privacy RightsChildren Online PolicyInterest-Based AdsAbout Nielsen MeasurementDo Not Sell My InfoContact UsDisney Ad Sales SiteCopyright Enterprises Inc All rights reserved

www.pexels.com

Page Meta Tags

Page Headers

0 HTTP/1.1 403 Forbidden
Date Thu, 12 Nov 2020 20:50:51 GMT
Content-Type text/html; charset=UTF-8
Connection close
CF-Chl-Bypass 1
Set-Cookie __cfduid=d9b46bd4aeeb0c05c764d620a5908a7b31605214251; expires=Sat, 12-Dec-20 20:50:51 GMT; path=/; domain=.pexels.com; HttpOnly; SameSite=Lax
Cache-Control private, max-age=0, no-store, no-cache, must-revalidate, post-check=0, pre-check=0
Expires Thu, 01 Jan 1970 00:00:01 GMT
X-Frame-Options SAMEORIGIN
cf-request-id 065fd2c198000073e5ca8a6000000001
Expect-CT max-age=604800, report-uri=”https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct”
Server cloudflare
CF-RAY 5f1320af482073e5-IAD

Keyword Frequency

Keyword Cloud

www.find-a-musician.com – Musicians Wanted and Available Classified Ads

Find Guitarists, Singers, Bassists, Drummers and all other Band Members Classified Ads for Musicians Wanted/Available. Register now and start searching today!

Page Meta Tags

keywords band classifieds, bass player wanted, free musician classifieds, musician search, musician seeking band, drummer available, drummer wanted, find musician, musician classified ads, musician ads, musician available, musician needed, musician wanted, guitarist seeks band, guitarist available, band seeking musician, find band member, find drummer, find guitarist, find singer, looking for singer, singer wanted, singer available, percussionists, pianist, piano player, saxophonists, search band, singer seeks band, singer seeks group, songwriter, start a band
description Find Guitarists, Singers, Bassists, Drummers and all other Band Members Classified Ads for Musicians Wanted/Available. Register now and start searching today!
application-name Find a Musician
msapplication-starturl /
msapplication-navbutton-color #3480C0
msapplication-window width=1024;height=768
msapplication-tooltip Find Musicians Wanted and Available
viewport width=device-width, initial-scale=1, minimum-scale=1.0, maximum-scale=1.0

Page Headers

0 HTTP/1.1 200 OK
Server nginx
Date Thu, 12 Nov 2020 20:50:50 GMT
Content-Type text/html; charset=utf-8
Connection close
Vary Array
Expires Thu, 19 Nov 1981 08:52:00 GMT
Cache-Control no-store, no-cache, must-revalidate
Pragma no-cache
Set-Cookie PHPSESSID=vdcjfd082h343fhp25cs00hjb9; path=/
X-Cache-Status MISS
Strict-Transport-Security max-age=15768000; includeSubDomains
gzip on;
gzip_disable MSIE [1-6]\.(?!.*SV1)”;
gzip_proxied any;
gzip_comp_level 5;
gzip_types text/plain text/css application/javascript application/x-javascript text/xml application/xml application/rss+xml text/javascript image/x-icon image/bmp image/svg+xml;
gzip_vary on;
X-Powered-By PleskLin

Keyword Frequency

guitar 267
play 255
lead 221
looking 177
bass 156
rock 133
who 120
people 119
ohio 114
contact 113

Keyword Cloud

Musicians Wanted and Available Classified Ads Find find-a-musician com menu musicians classifieds register login Below are just some of our ads Once you create an account can search all the database narrow your to help find what you’re looking for It’s easy place ad Creating takes less than a minute with more joining everyday finding that Musician or play could soon become reality What have got lose Create today Click here I’m Any String Guitarist Accordion Player Acoustic Backing Vocalist Banjo Bass Bassoonist Cellist Clarinet Composer DJ Double Drummer Flutist French Horn Harmonica Keyboard Lead Oboe Organist Percussionist Pianist Producer Rhythm Saxophonist Song Writer Teacher Trombonist Trumpet Tuba Vibraphone Viola Violinist in Ohio Alabama Alaska Arizona Arkansas California Colorado Connecticut Delaware Florida Georgia Hawaii Idaho Illinois Indiana Iowa Kansas Kentucky Louisiana Maine Maryland Massachusetts Michigan Minnesota Mississippi Missouri Montana Nebraska Nevada New Hampshire Jersey Mexico York North Carolina Dakota Oklahoma Oregon Pennsylvania Rhode Island South Tennessee Texas Utah Vermont Virginia Washington DC West Wisconsin Wyoming Or seeking Guitarists Players Vocalists Bassoonists Cellists Composers DJs Drummers Flutists Organists Percussionists Pianists Producers Saxophonists Writers Teachers Trombonists Violinists Color Key nbsp Male Female Band Not Stated Seeking Mikebell London Contact Us Share this Profile Our Genres Heavy metal We Guitar Vocals We’re people who Drums Me lead vocalist searching drummer bass guitarist For band we name style so message me if interested click see COOKIE Columbus Franklin County Standard Professional Practice Place Home Studio Demo Checkout demo Keyboards Looking skilled Progressive Rock Metal styles ie Dream Theater Rush etc mostly playing recording original material must experience track Must be committed rehearsing at least once every weeks as most should learned prepared free time between rehearsals Hope shows scene make comeback after COVID meantime writing music video is priority Jochurch yr old At I Piano Organ accompany men’s chorus Who sing spirituals Hymns And need substitute player them during my absence CosmicGraffiti Excellent Hard Jazz Funk bassist comfortable improvisation songwriting preferably vocals gigs regularly typically month write record own songs musician passionate about their craft able rehearse week If contact Tom email us Look up on Instagram officialcosmicgraffiti Panurge My Percussion played drums cover bands originals I’ve been years join unique that’s not afraid experiment different genres main instrument but little bit everything needed Prog fusion favorite craigL Beginner Hi Craig am currently level ive never tour any concerts i try good crew it always makes feelings because cant one none im anybody please dont hesitate let know thank will appreciate stay blessed jodo baggins Lancaster Fairfield Searching Ella Fitzgerald Billie Holiday Peggy Lee quot tribute act spirit Stray Cats White Stripes Jon Spencer Blues Explosion was previously house singer speakeasy Goal gigging by no later spring ready climbing guitar demos available This female led fronted LGBTQ friendly don’t mind traveling reasonable distance practice Arcaneguardian scream influences avenged sevenfold enemies ice nine kills chelsea grin miah type love too amp really want grow punk rock r b fun hope someone gives chance didactics Fully Subscribed Member Good preexisting jazz funk progressive thats read sheet has basic understanding theory plays both string six since excellent sight reader knowledge actually majoring performance Capitol university lyricist formal vocal training new parts odd signatures polyrhythms also adding keyboardist rhythm same potentially members contribute creative process expected show rehearsal call use together go over basically practiced earley justink gmail through texting HaydenG Grove City RocknRoll Punk year dedicated consistent Interests s alt Sing life Hello All form group like minded enjoy Christian Gospel songwriter rearrange well singing many would opportunity add lyrics fayemariemusic Ok Garage Pop Indie Faye Marie singer-songwriter from OH m potential tours passion do business take full speed individuals forward chatting JJDrum Folk Reggae blues mixed reggae Also hand drum great acoustic acts few improvisations structured perhaps put either out anything else Cvaughan ideally reliable already established coverband open startup An mic when comes away standards much possible durring works other weekend stuff PA don t ego sound mess genre Rockerchick Soft high energy classic range powerful voice diva sharing stage male Enjoy duets Can back-up harmonies Have sung last hard soft Am Play percussion Repertoire includes Journey Foreigner Boston Fleetwood Mac Alllman Brothers Pat Benatar Annie Lennox Special Bonnie Raitt leads keys Coffeelips Im mainly into Alternative ukulele piano JJBassPlayer Hip hop ve months practically day something curious used school turns pretty YouTube It seems along ear very while figuring pattern tunes Now real Really build Playing creating EdenWoods Eden started Harmonic Westerville now exploring multiple instruments order better understand production Mojoman piece Regional Traditional R B Original Four CDs Tomfitz Country southern newer country Currently working second scheduling opportunities next Ronbo based keyboard primarily pop Example Led Zeppelin Janis Joplin Sublime SRV Beth Hart Joe Walsh Aerosmith The consists keyboards Age required age ‘s common thread DarealChickenJoe Pickaway Year whos Hardcore done recordings live near anywhere there KlbKing Pataskala Licking metalcore maybe even I’d prefer feel jamming beyond Maddog tend toward metals d doom thrash Cwest Blacklick haven had luck wide baritone-soprano fit Scottie Marysville Union Bluegrass traditional rock-a-billy talented Quentinbro ohio havent Biggest Radiohead radical face jack white CalypsoZamo professional written willing give Songs cappella tracks Hawk dad church pastor kiss AC creed CCR mild cringe late Maxwell couple serious fed became roadie eyeball then attended Mic jam Sundays nd zylaphones kazoos pots pans care long interest being jukebox ok drinking SONGS going leave boat way cannot commit rather watch football expand beer gut DO NOT RESPOND TO THIS AD equipment grind fingers hour More point hoping hear seriouse muscians greatest f occasion off learn throw fake bars I’ll hum ENTIRE BAND JaredCamp permanent gig Aaven W Etch Thornville Perry qwertyuiopasdfghjklzxcvbnmvcbggs htrs gtw w wwwwwwwwww ww JaredFetzer Like alternative somepop solid tenor versatile chill work maniac awesome Coonrod Springfield Clark Classic dance backup proffesional Dorrch Mount Gilead Morrow LOVES travel ProCougarHunter Just wanna hit trying Join Start share vision Chrisstc Lima Allen vicalist project making back skills plus amount fellow bandmates get ball rolling Based area Lawbug Marion beginner flexible son connect HOURSXINXPURGATORY Stockport Morgan Classical missing puzzle wish complete learning teachers lost lightning strike In loss gained spark electricity within putting method madness shelby Need LadyPipes Bucyrus Crawford recorded three CD’s compilations Already switch Genre variety mix Back seasoned team gear transportation right attitude communication connection clear headed meaning casual drink drunks No drugs those consider hobby apply hiring particular players Gappy Xenia Greene another four peice Some Alice Chains Metallica Nirvana Stained Seether covers song writer ideas Please shmabgab Dayton girlband starting having Preferably we’re leaning towards alternative-indie e Cranberries Weepies AKB kind fry growl crazy lmao Hit Pacom Fairborn Hall Campus Pastor Be Church contemporary worship Elevation Hillsong Passion Bethel ways involve Check JBdrummer Zville occasional sessions prefers shop smooth laid environment stars Rogerg older Waylon Hank Jr Alan Jackson David Allan Coe called snakejuice Mansfield around central Jay Troy Miami number Got Would grunge wouldn opposed party dana Dana performed before why backing might tastes generally indie artists Chemical Romance A Day To Remember Prevail Lana Del Rey YUNG BLUD Halsey Chase world part touring democratic locked occupational contract until January happily unemployed spending set That’s irrational how gonna only thing ever felt confident plan marketing negotiation far sang low took courses Yes producing space say truly hold Third Eye Blind Meshuggah Vivaldi Britney Spears except post- seriously lover Militia hardcore front man guy girl isn issue Send Goodspeedcaleb Courthouse Bingle huge emo lot did Open doing Influenced Dirty Nil Emery Senses Fail Used Underoath Dorian hotz aggressive loud Kiwis loves Oliver collaborate experienced wanting perform regular basis BrandonW Whatever think Tesaluvs Waynesville Violin country-rock Stage presence solo duo mates Capt Daughter performing historic events close Style folk Irish early bodhran recorders possibly Die plz Centerville Montgomery Industrial types classical lately though Bohemian Rhapsody maddmarx Electronic On essentially given decent electric kit simply apartment reason Gigging isn’t however eventually Jweiss Shelby Richland guitars home Bellamontigue Trained alto soprano Sam Sparrow’s black n gold Natalie King cole ‘s- favorites large single mom ans schedule venues miles Tjguitar influenced shinedown Three days grace Reno Englewood lean modern Theory deadman list relatively quick DjBillBoy Dj From Vegas Put N Bay small dimension performances HopeCollins young album start Bailey Lebanon Warren experimental Psychedelic shred weird But straight calls alot tool chains Red hot chili peppers Hendrix Anything Jjskillz Cincinnati Hamilton sounds Chris Cornell limited happens Life short let’s allymarie High Schooler roll almost Lumineers Zepplin Doors Mt Joy book Billyjack bjams yo February ton myself intermediate Into soul haven’t non-seasoned Fine hangups BatesDTS Deceiving Spectre Deathcore Death were past provided bring cymbals Serious DeceivingTheSpectre deathcore wrapping first studion begin massive drug issues AshTalion Brookville Self-taught dabbled creativity behind Limited town Very mixing still driving keen commitment include Oceans Ate Twelve Foot Ninja Chon Audioslave psychedelicsleep Germantown runaways suzi quatro joan jett baez joni mitchell ages BryanBranham Millersport heavy end spectrum fill Covers steveb Willard Huron Older gentleman grew Full wouldn’t question harmonize others anyone wants carry melody Durbify Cambridge Guernsey metal-rock cambridge drive People they his megadeth motley crue pantera motorhead sabbath iron maiden ac dc continues these describe funky Msg msg Amt heavily Jack Black Keys blink career James Winchester Adams sorts aka Tim McGraw george strait alan kenny Chesney Sheryl crow Void shouting screaming slight EP extremely frontman you’d talk capabilities interests LeevonNero blending Laynebarger Carey Wyandot highschool finish oasis green hopefully Message Thanks Toecutter crowd excited Maybe shot knows pedroziese Tiffin Seneca kid lived Brazil several scratch composed writers dream big believe talent happen Jdbailey Williamsburg Clermont Been Heavily inspired sleep wizard kyuss such gcarpenter Findlay ll Madisondaugherty Butler practicing backtracks improve harmonization versed Morganapaige uncle thought friends places cinncinatirevialleader expierence teen Corbani choir musicals Davecatbone trio Seek authentic quartet Id See Royobabe Oxford Area Saxophone wife Geriatric stripes Billy Darkstar vein Mike Howe Mark Osagueda Bobby Blitz twice motivated Thelifelongjellies Philadelphia Tuscarawas Lost job Someone Dynamics Pretty punky Rocky jammy hip-hop points rough listen booked cancelling enough nice background Work beats changes re Militia-band current quit terms Menu FAQ lt Links Terms Conditions Privacy Policy Cookies copy Find-a-Musician Local

www.qsc.com – Musicians and Bands – Applications – Live Sound – QSC

Page Meta Tags

generator TYPO3 CMS
viewport width=device-width, initial-scale=1, user-scalable=0
title Musicians and Bands – Applications – Live Sound – QSC
date 2019-01-18

Page Headers

0 HTTP/1.1 200 OK
Date Thu, 12 Nov 2020 20:50:45 GMT
Content-Type text/html; charset=utf-8
Connection close
Set-Cookie __cfduid=df17da1cf388987e1c60479751bef04081605214245; expires=Sat, 12-Dec-20 20:50:45 GMT; path=/; domain=.qsc.com; HttpOnly; SameSite=Lax
Content-Language en
Expires Fri, 13 Nov 2020 08:00:00 GMT
Cache-Control max-age=44693
Pragma public
cf-2fa-verify 2e3966d7f8c238f
X-UA-Compatible IE=edge,chrome=1
CF-Cache-Status HIT
Age 4538
cf-request-id 065fd2aab7000028d3f5988000000001
Expect-CT max-age=604800, report-uri=”https://report-uri.cloudflare.com/cdn-cgi/beacon/expect-ct”
Report-To {“endpoints”:[{“url”:”https:\/\/a.nel.cloudflare.com\/report?s=SBYuKeI9OwU0JcggcQ3xg%2BNTWmfBLknzTa1Tiurp9%2Bw93tiA6ZgU%2Bb4DhSKLnoQzojyJMC0qlMNzzKz0395GSiwSsfZkNQqxELn02A%3D%3D”}],”group”:”cf-nel”,”max_age”:604800}
NEL {“report_to”:”cf-nel”,”max_age”:604800}
Server cloudflare
CF-RAY 5f13208aa87e28d3-IAD

Keyword Frequency

series 85
sys 41
cx 31
tad 28
mount 21
yoke 20
usl 19
kw 17
kit 17
surface 17

Keyword Cloud

Musicians and Bands Applications Live Sound QSC Audio Products Homepage Menu CorporateAbout usCareersProductsAll ProductsLive ProductsAccessoriesTouchMix MixersQSC iTouchMix SweepstakesPreset LibrariesTouchMix- TouchMix- ProCompatible External Control SurfacesTouchMix AccessoriesTouchMix- Rack Mount Kit TMR- Pro Carrying ToteTouchMix- Dust CoverTouchMix- Tablet Support Stand TS- Power AmplifiersGX SeriesGX GX GXD SeriesGXD RMXa SeriesRMX aRMX aPLX SeriesPLX PLX Powerlight SeriesPL PLD SeriesPLD Amplifier NavigatorLoudspeakersActive LoudspeakersK SeriesCP SeriesKW SeriesKS SeriesPassive LoudspeakersE SeriesActive Line Array LoudspeakersKLA LoudspeakersWideLine SeriesWideLine SeriesStage MonitorsK K CP KW Active SubwoofersKS KS CKW KLA Passive SubwoofersE SeriesGP SeriesSystems ProductsQ-SYS EcosystemSolutionsQ-SYS ControlAV C System Monitoring ManagementEnterprise-wide Video ControlConnected Conferencingconnected meeting room for enterpriseProducts Peripherals AccessoriesAttero TechNV Series NV- -H Q-SYS CoresConference Room IntegrationNetwork Touch Screen ControllersNetwork I O PeripheralsNetwork AmplifiersSoftware Feature LicensesNetwork Page StationsNetwork SwitchesAccessoriesSoftwareQ-SYS Designer SoftwareResourcesQ-SYS Networking Solutions rd Party Telephony IntegrationQ-SYS ConfiguratorDiscontinued ProductsPower AmplifiersEnergyStar AmplifiersSPA SeriesCommercial AmplifiersISA SeriesCMXa SeriesMP-A Amplifiers Dataport CX -ChCX -ChDSP USB CXD SeriesDSP Network CX-Q SeriesCXD-Q SeriesAmplifier SoftwareAmplifier NavigatorCXD Speaker Profiles LibraryAmplifier AccessoriesDiscontinued ProductsLoudspeakersSolutionsAcousticDesign SolutionsSurface-mount LoudspeakersAcousticCoverage Surface-MountAcousticDesign Surface-MountAcousticPerformance SeriesCeiling-mount Ceiling-MountAcousticDesign Ceiling-MountColumn Surface-mount LoudspeakersAcousticDesign Column Surface-MountPendant-mount Pendant-MountActive Installed SeriesKLA SeriesInstalled LoudspeakersILA SeriesSubwoofersAcousticDesign SeriesAcousticPerformance SeriesSmall-Format SUB SATAcousticDesign SAT LoudspeakersLoudspeaker Modeling SoftwareDiscontinued ProductsMixersMP-M SeriesMP-M MP-M MP-MFC ControllerCinema ProductsProcessingQSC ProcessorsDCP SeriesDigital Expansion ProcessorDPM SeriesDCM SeriesMonitorsUSL ProcessorsUSL JSD- USL DAX- XTM- AQ-SYSNV CoresCore FlexCore NanoQ-SYS Cinema Core cQ-SYS cNetwork PeripheralsDCIO DCIO-HI O- FlexI FrameI CardsNetwork SwitchesQ-SYS SolutionsQ-SYS NS SwitchesAdditional Switch DocumentsNetwork Touchscreen Controller PeripheralsTSC- w-G TSC- wTSC- tNetwork AmplifiersDPA-Q SeriesNew DPA-Q IntegrationQualified SwitchesDisqualified SoftwareQ-SYS ConfiguratorQ-SYS SupportNetwork DSP SoftwareAccessoriesPower AmplifiersDCA SeriesDCA DCA DPA SeriesDPA Navigator SeriesDPA-Q QDPA QnDPA QnNew SeriesISA ISA TiISA TiLoudspeakersScreen Channel Loudspeakers -way Bi-amp Bi- or Tri-amp Tri- Quad-ampLF ComponentsMid-Hi ComponentsHF ComponentsSurround LoudspeakersSR- SR- AcousticDesign Surface MountSubwoofersSB- SB- FSB- FGP -swGP -swLobby LoudspeakersSmall-Format MountAD-S AccessoriesAcousticDesign Ceiling MountAcousticDesign Pendant MountAcousticCoverage MountReference Monitor SystemRSC- RSB- AcousticPerformance AP AP- Accessibility SolutionsUSL CCH- CCR- IRH- UPC PackagesMedia ServersTest MeasurementLSS- PCA- DAT- MMP- SolutionsResourcesResourcesKnowledge BaseDocument LibraryVideo LibraryForumSoftware FirmwareResourcesMP-M FirmwareMP InstallTouchMixDigital ProcessorsQ-SYS NavigatorGXD Firmware UpdaterLoudspeakersLegacy ProductsResourcesQSControl net SoftwareSignal ManagerSC- Attero Tech FirmwareunIFY PanelQ-SYS ToolsEASE LibraryCF LibraryComplianceWarranty StatementAmplifier Model SelectorTrainingSupportProduct amp Application SupportProduct RegistrationSelf Service ResourcesSpare Parts StoreProduct RepairProduct SupportService CentersRebate ProgramsDiscontinued ProductsProduct SupportQ-SYS Legacy DSPAmplifiersLoudspeakersGeneral PolicyDomestic Terms of ServiceNewsLive SoundProductsAccessoriesTouchMix SeriesK ToteK Outdoor CoverK Yoke KitK KitQSC AccessoriesM Eyebolt Kit-CSP- X Extension PoleQSC Lock Out CoverCP ToteCP YokeCP AccessoriesKW CKS AccessoriesKS CVRKS CoverKS-LOCSP- PoleSP- Loudspeaker PolePassive SeriesE E CoverE MountM Kit-AE Kit-WE CoverM swE sw CoverCASTER KIT-LE Sample SystemsActive ToteKLA SP- PoleKLA CoverKLA M KitKLA FramesPassive SeriesWL WL -swWideLine -wWL -swStage swGP -swApplicationsMusicians BandsMobile EntertainersHouses WorshipEvent ProductionPresentersClubs VenuesResourcesVideo LibraryDocument LibrarySoftware FirmwareTouchMixEthernetQualified Hard DrivesTouchMix DAW UtilityFirmware Change LogRelease NotesAmplifier NavigatorLoudspeaker ProfilesBuilt-in PresetsPrevious ReleasesLoudspeakersLegacyQSControl Knowledge BaseWideline Owners GroupForumSupportTrainingBuy AuthorizedNewsBlogFinancingContact UsSystemsProductsQ-SYS ManagementReflect Referral Reseller PartnerEnterprise-wide TechAT Wall-Mount InterfacesunBT AunD IO-BTunDX IO unDX IunD IOAxon D iAT Surface-Mount InterfacesAxon A FLEXAxon MioAxon FLEXioAxon DBUunHX DunDIO x unD I-LunD OAT Rack-Mount InterfacesSynapse DM Synapse MioSynapse MiSynapse iSynapse oAttero Paging StationsZip Zip GAttero Wall ControllersAxon Monioring PeripheralsunDNEMOAttero AmplifiersAxon DTH Analog ExtendersAxiom ML Axiom BT AXP OAxiom AXPioAttero AccessoriesNV CoresNV- CapableCore NanoCore fCore f FAQCore iCore FlexConference IntegrationPTZ-IP Conference CamerasI O-USB BridgeNetwork ControllersTSC- PeripheralsCore i in Frame Mode AmplifiersCX-Q SeriesCX-Qn CX-Qn CXD-Q SeriesCXD QCXD QnCXD QnSoftware LicensesSoftware-based DanteQ-SYS UCI EditorQ-SYS Scripting EngineNetwork StationsPS- GPS- HPS- HPS-XNetwork DocumentsAccessoriesWCP- WCP- SoftwareApproved Independent ProgrammersArchivesResourcesQ-SYS SeriesSPA SPA Commercial TiCMXa SeriesCMX VaCMX VaMP-A VMP-A VCommercial VCX VDSP QnAmplifier Surface-MountAC-S TAC-S TAcousticDesign Surface-MountAD-S TAD-S AD-S swAD-S TwAD-S HAD-S AccessoriesAD-S T MountX-MountAcousticPerformance SeriesAP- mAP- swAP- YokesAP-YM MountAP-YM m MountCeiling-mount Ceiling-MountAC-C TAC-C T-LPAC-C T-nbAC-C T-nbAcousticDesign Ceiling-MountAD-C TAD-C T-LPAD-C TwAD-C AD-C TPendant-mount Pendant-MountAD-P TAD-P HALOActive FirmwareK CoverKW Suspension KitM Kit-WKW ToteM Kit-CKLA CoverSP- FramesInstalled iWL -swSubwoofersAcousticDesign SeriesAD-S TwAcousticPerformance SeriesAP -swKS GP -swSmall-Format LoudspeakersAD-C SATAD-C SUBAD-P SATAD-P SUBAD-S SATAD-S SUBLoudspeaker ControllerSolutionsBusiness MusicHospitalityPerformance VenuesEducationgovernment lifesafetyTransportationHOW House Of WorshipSport VenuesResourcesDocument DownloadsCase StudiesKnowledge BaseQ-SYS ConfiguratorQualified SwitchesBlogPartnersSupportTrainingNewsStrategic AlliancesFinancingContact UsCinemaProductsProcessingQSC SeriesDCP DCP SoftwareDigital ProcessorDigital SeriesDPM HDPM HDCM DDCM DCM SoftwareMonitorsUSL CM- EUSL SwitchesJuniperLinksys SRW SeriesDisqualified SeriesSpeaker ProfilesVersion Release NotesPrevious ReleasesDPA-Q PassiveSC- XSC- SC- XC Bi-ampSC- CSC- Tri-ampSC- C-FSC- Quad-ampSC- FSC- LF SWSubwoofersSB- SUBAcousticDesign SWAD-S Kit-CX-MountAcousticDesign MountAD-C MountAD-P HALOAcousticCoverage MountAC-S TAcousticCoverage MountAC-C TReference SolutionsLarge SolutionsMid-Size SolutionsSmall SolutionsCritical Listening ApplicationsImmersive SoundResourcesCase StudiesDocument DriversDigital ProgrammersAmplifier ProfilesProfile vs PresetsPLD PresetsVersion ReleasesLegacyQSControl Shipping Weights DimensionsTech TipsNewsOnline GuideVideosTrailersQSC Theatre LocationsSupportNewsTrainingContact a DealerTheatre LocationsFinancingContact UsQSC Home Careers Contact Us Global Sites Corporate Site English India DeutschEspa olFran ais ItalianoPortugueseMagyar Login Search SoundSystemsCinemaQSC ProductsSolutionsResourcesSupportTrainingNewsStrategic QSCLive SoundApplicationsMusicians PA Reinforcement Stage Monitors Musical Instrument Amplification The purpose sound reinforcement system is to deliver your music the audience with clarity power Whether you re performing solo an intimate setting bringing it larger we ve got gear need do right Intimate performance coffee house lounge parties venue may be modest size but requirements quality are high offers products that will studio-quality compact at affordable price Volume levels lower due providing vocals augmenting acoustic instruments Drums percussion horns not typically running through nbsp Recommended View Selector Mixers TouchMix Mid-size venues crowds clubs live Your drums onstage amps able cover crowd project some Due potential necessity playing volume dancing most all main Kick drum miked bass amplifier electric guitar amplifiers run Larger You working higher want concert experience plenty kicking low-end Because consistently area guitars keyboards WideLine ResourcesResources Guides Solo Duo Event Production AV Entertainment Portable Other Training Videos Tunings Important qualities stage monitor reliability In order have inspired s essential hear yourself other musicians clearly comfortable without feedback has designed number loudspeakers optimal use Systems Many today digital headroom uncolored reproduce instrument distortion harshness muddiness That where Family powered come Perfectly clear handle peak transients demanding dynamic full-range Keyboards Synthesizers Acoustic Electric Guitar Ukulele Mandolin etc Bass Guitars Electronic modeling processors selection depends on speakers using If looking already own our Amp Tool three types Conventional legendary audio Dual channel Multi-channel Understanding Mobile Entertainers Houses Worship Presenters Clubs Venues About QSCCompany ProfileExecutive TeamCareersContact UsConnect With QSCWebsite FeedbackSolutions ApplicationsLive SoundSystemsCinemaResourcesNews EventsForumDocument FirmwareSupportWarranty InformationProduct Repair Facebook LinkedIn Twitter YouTube Instagram Copyright copy LLC ConditionsTerms SalePrivacy PolicyCookie PolicyCA Transparency Supply Chains ActComplianceTrademark Usage GuidelinesISO Conformance We cookies understand how site improve By continuing accept Cookie Policy Privacy Conditions Ok Close modal